Recombinant Full Length Human C9orf66 Protein, GST-tagged
| Cat.No. : | C9orf66-2721HF |
| Product Overview : | Human C9orf66 full-length ORF (BAB70995.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 295 amino acids |
| Description : | C9orf66 (Chromosome 9 Open Reading Frame 66) is a Protein Coding gene. |
| Molecular Mass : | 57.5 kDa |
| AA Sequence : | MRHSVARPTRLPRRLSPFWDPATCKNLEGGAGEVVRGRDPRRLRTSRSTEILGEGLAGPSAGAAARPAAPPPQPREPGAPGLRRAPPRTRMDSSGLGPCSEAPLHTSAGLSGRNLRAAGGVLPVDLERERAALCARQSGHGPPAVRWLLGSRGAESGGLARRRVAAEHAQPSANLVCRSALETSAFPPSKPKSPRGRVRARSSDGRLRHPAWRAGSGGRGGRGPSAELASRYWGRRRALPGAADLRPKGARADDRRPLRAGRKLHLPEAARLPGNVGKSGEPHKAGEVGNHPRDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | C9orf66 chromosome 9 open reading frame 66 [ Homo sapiens ] |
| Official Symbol | C9orf66 |
| Synonyms | RP11-59O6.1 |
| Gene ID | 157983 |
| mRNA Refseq | NM_152569 |
| Protein Refseq | NP_689782 |
| UniProt ID | Q5T8R8 |
| ◆ Recombinant Proteins | ||
| C9orf66-0209H | Recombinant Human C9orf66 Protein, GST-Tagged | +Inquiry |
| C9orf66-2721HF | Recombinant Full Length Human C9orf66 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C9orf66 Products
Required fields are marked with *
My Review for All C9orf66 Products
Required fields are marked with *



