Recombinant Full Length Human CA11 Protein, GST-tagged
Cat.No. : | CA11-2732HF |
Product Overview : | Human CA11 full-length ORF (AAH02662.1, 1 a.a. - 328 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 328 amino acids |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA XI is likely a secreted protein, however, radical changes at active site residues completely conserved in CA isozymes with catalytic activity, make it unlikely that it has carbonic anhydrase activity. It shares properties in common with two other acatalytic CA isoforms, CA VIII and CA X. CA XI is most abundantly expressed in brain, and may play a general role in the central nervous system. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 61.71 kDa |
AA Sequence : | MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA11 carbonic anhydrase XI [ Homo sapiens ] |
Official Symbol | CA11 |
Synonyms | CA11; carbonic anhydrase XI; carbonic anhydrase-related protein 11; CA RP XI; carbonic anhydrase related protein 2; carbonic anhydrase related protein XI; CARP2; CARPX1; CA-XI; CARP-2; CARP XI; CA-RP II; carbonic anhydrase-related protein 2; carbonic anhydrase-related protein XI; |
Gene ID | 770 |
mRNA Refseq | NM_001217 |
Protein Refseq | NP_001208 |
MIM | 604644 |
UniProt ID | O75493 |
◆ Recombinant Proteins | ||
CA11-50H | Recombinant Human CA11, His-tagged | +Inquiry |
CA11-0231H | Recombinant Human CA11 Protein, GST-Tagged | +Inquiry |
CA11-2732HF | Recombinant Full Length Human CA11 Protein, GST-tagged | +Inquiry |
CA11-0354H | Recombinant Human CA11 Protein (His24-Arg328), C-His-tagged | +Inquiry |
CA11-10614H | Recombinant Human CA11, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA11-7916HCL | Recombinant Human CA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA11 Products
Required fields are marked with *
My Review for All CA11 Products
Required fields are marked with *
0
Inquiry Basket