Recombinant Full Length Human CA13 Protein, GST-tagged
| Cat.No. : | CA13-2735HF |
| Product Overview : | Human CA13 full-length ORF (NP_940986.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 262 amino acids |
| Description : | Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008] |
| Molecular Mass : | 55.8 kDa |
| AA Sequence : | MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CA13 carbonic anhydrase XIII [ Homo sapiens ] |
| Official Symbol | CA13 |
| Synonyms | CA13; carbonic anhydrase XIII; carbonic anhydrase 13; CAXIII; FLJ37995; MGC59868; CA-XIII; carbonate dehydratase XIII; FLJ36434; |
| Gene ID | 377677 |
| mRNA Refseq | NM_198584 |
| Protein Refseq | NP_940986 |
| MIM | 611436 |
| UniProt ID | Q8N1Q1 |
| ◆ Recombinant Proteins | ||
| CA13-1048H | Recombinant Human CA13 Protein (M1-H262), Tag Free | +Inquiry |
| CA13-1049H | Recombinant Human CA13 Protein (M1-H262), His/Strep tagged | +Inquiry |
| CA13-10616H | Recombinant Human CA13, His-tagged | +Inquiry |
| CAR13-2715M | Recombinant Mouse CAR13 Protein | +Inquiry |
| CA13-2735HF | Recombinant Full Length Human CA13 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA13 Products
Required fields are marked with *
My Review for All CA13 Products
Required fields are marked with *
