Recombinant Full Length Human CABCOCO1 Protein, GST-tagged

• Cat.No.: CABCOCO1-1703HF
• Product Overview: Human CABCOCO1 full-length ORF ( NP_775825.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 208 amino acids
• Description: Predicted to enable calcium ion binding activity. Predicted to be located in centrosome; cytoplasm; and sperm flagellum.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 50.3 kDa
• AA Sequence: MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIYSTFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQIQEEAFNARIEKLKKA
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CABCOCO1 ciliary associated calcium binding coiled-coil 1 [ Homo sapiens (human) ]
• Official Symbol: CABCOCO1
• Synonyms: bA63A2.1
• Gene ID: 219621
• mRNA Refseq: NM_173554.2
• Protein Refseq: NP_775825.1
• UniProt ID: Q8IVU9