Recombinant Full Length Human CABYR Protein, C-Flag-tagged
Cat.No. : | CABYR-1518HFL |
Product Overview : | Recombinant Full Length Human CABYR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES TAETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CABYR calcium binding tyrosine phosphorylation regulated [ Homo sapiens (human) ] |
Official Symbol | CABYR |
Synonyms | CT88; FSP2; CBP86; FSP-2; CABYRa; CABYRc; CABYRe; CABYRc/d |
Gene ID | 26256 |
mRNA Refseq | NM_012189.4 |
Protein Refseq | NP_036321.2 |
MIM | 612135 |
UniProt ID | O75952 |
◆ Recombinant Proteins | ||
CABYR-2804HF | Recombinant Full Length Human CABYR Protein, GST-tagged | +Inquiry |
Cabyr-1927M | Recombinant Mouse Cabyr Protein, Myc/DDK-tagged | +Inquiry |
CABYR-482H | Recombinant Human CABYR Protein, His (Fc)-Avi-tagged | +Inquiry |
CABYR-1518HFL | Recombinant Full Length Human CABYR Protein, C-Flag-tagged | +Inquiry |
CABYR-354C | Recombinant Cynomolgus CABYR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CABYR-7905HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
CABYR-7906HCL | Recombinant Human CABYR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CABYR Products
Required fields are marked with *
My Review for All CABYR Products
Required fields are marked with *
0
Inquiry Basket