Recombinant Full Length Human CACFD1 Protein, GST-tagged
| Cat.No. : | CACFD1-2805HF |
| Product Overview : | Human CACFD1 full-length ORF (NP_060056.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 172 amino acids |
| Description : | CACFD1 (Calcium Channel Flower Domain Containing 1) is a Protein Coding gene. Among its related pathways are Transmission across Chemical Synapses and DREAM Repression and Dynorphin Expression. GO annotations related to this gene include calcium channel activity. |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAAGVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CACFD1 calcium channel flower domain containing 1 [ Homo sapiens ] |
| Official Symbol | CACFD1 |
| Synonyms | C9orf7; FLOWER; D9S2135 |
| Gene ID | 11094 |
| mRNA Refseq | NM_017586 |
| Protein Refseq | NP_060056 |
| MIM | 613104 |
| UniProt ID | Q9UGQ2 |
| ◆ Cell & Tissue Lysates | ||
| CACFD1-7926HCL | Recombinant Human C9orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CACFD1 Products
Required fields are marked with *
My Review for All CACFD1 Products
Required fields are marked with *



