Recombinant Full Length Human CALCB Protein, GST-tagged
| Cat.No. : | CALCB-3048HF |
| Product Overview : | Human CALCB full-length ORF (1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 138 amino acids |
| Description : | CALCB (Calcitonin Related Polypeptide Beta) is a Protein Coding gene. Diseases associated with CALCB include Medullary Thyroid Carcinoma, Familial. Among its related pathways are Presynaptic function of Kainate receptors and Peptide ligand-binding receptors. GO annotations related to this gene include hormone activity and neuropeptide hormone activity. An important paralog of this gene is CALCA. |
| Molecular Mass : | 41.3 kDa |
| AA Sequence : | MKKEANLQRGGMGFRKFSPFLALSILVLYQAGSLQAAPFRSALEGSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CALCB calcitonin-related polypeptide beta [ Homo sapiens ] |
| Official Symbol | CALCB |
| Synonyms | CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II; |
| Gene ID | 797 |
| mRNA Refseq | NM_000728 |
| Protein Refseq | NP_000719 |
| MIM | 114160 |
| UniProt ID | P10092 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALCB Products
Required fields are marked with *
My Review for All CALCB Products
Required fields are marked with *



