Recombinant Full Length Human CALCB Protein, GST-tagged

Cat.No. : CALCB-3048HF
Product Overview : Human CALCB full-length ORF (1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 138 amino acids
Description : CALCB (Calcitonin Related Polypeptide Beta) is a Protein Coding gene. Diseases associated with CALCB include Medullary Thyroid Carcinoma, Familial. Among its related pathways are Presynaptic function of Kainate receptors and Peptide ligand-binding receptors. GO annotations related to this gene include hormone activity and neuropeptide hormone activity. An important paralog of this gene is CALCA.
Molecular Mass : 41.3 kDa
AA Sequence : MKKEANLQRGGMGFRKFSPFLALSILVLYQAGSLQAAPFRSALEGSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
Official Symbol CALCB
Synonyms CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Gene ID 797
mRNA Refseq NM_000728
Protein Refseq NP_000719
MIM 114160
UniProt ID P10092

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CALCB Products

Required fields are marked with *

My Review for All CALCB Products

Required fields are marked with *

0
cart-icon