Recombinant Full Length Human CALCOCO2 Protein, C-Flag-tagged
Cat.No. : | CALCOCO2-770HFL |
Product Overview : | Recombinant Full Length Human CALCOCO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a coiled-coil domain-containing protein. The encoded protein functions as a receptor for ubiquitin-coated bacteria and plays an important role in innate immunity by mediating macroautophagy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.1 kDa |
AA Sequence : | MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF NCPICDKIFPATEKQIFEDHVFCHSLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CALCOCO2 calcium binding and coiled-coil domain 2 [ Homo sapiens (human) ] |
Official Symbol | CALCOCO2 |
Synonyms | NDP52 |
Gene ID | 10241 |
mRNA Refseq | NM_005831.5 |
Protein Refseq | NP_005822.1 |
MIM | 604587 |
UniProt ID | Q13137 |
◆ Recombinant Proteins | ||
CALCOCO2-2543H | Recombinant Human CALCOCO2 protein, His-tagged | +Inquiry |
CALCOCO2-2884Z | Recombinant Zebrafish CALCOCO2 | +Inquiry |
CALCOCO2-10661H | Recombinant Human CALCOCO2, GST-tagged | +Inquiry |
CALCOCO2-487H | Recombinant Human CALCOCO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CALCOCO2-770HFL | Recombinant Full Length Human CALCOCO2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALCOCO2-7893HCL | Recombinant Human CALCOCO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALCOCO2 Products
Required fields are marked with *
My Review for All CALCOCO2 Products
Required fields are marked with *
0
Inquiry Basket