Recombinant Full Length Human CALY Protein, GST-tagged
| Cat.No. : | CALY-3083HF | 
| Product Overview : | Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 217 amino acids | 
| Description : | The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 50.27 kDa | 
| AA Sequence : | MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CALY calcyon neuron-specific vesicular protein [ Homo sapiens ] | 
| Official Symbol | CALY | 
| Synonyms | CALY; calcyon neuron-specific vesicular protein; dopamine receptor D1 interacting protein, DRD1IP; neuron-specific vesicular protein calcyon; CALCYON; NSG3; calcyon protein; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); DRD1IP; RP11-122K13.5; | 
| Gene ID | 50632 | 
| mRNA Refseq | NM_015722 | 
| Protein Refseq | NP_056537 | 
| MIM | 604647 | 
| UniProt ID | Q9NYX4 | 
| ◆ Recombinant Proteins | ||
| Caly-1942M | Recombinant Mouse Caly Protein, Myc/DDK-tagged | +Inquiry | 
| CALY-2662M | Recombinant Mouse CALY Protein | +Inquiry | 
| RFL20361RF | Recombinant Full Length Rat Neuron-Specific Vesicular Protein Calcyon(Caly) Protein, His-Tagged | +Inquiry | 
| CALY-3083HF | Recombinant Full Length Human CALY Protein, GST-tagged | +Inquiry | 
| CALY-612R | Recombinant Rhesus monkey CALY Protein, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALY Products
Required fields are marked with *
My Review for All CALY Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            