Recombinant Full Length Human CALY Protein, GST-tagged
Cat.No. : | CALY-3083HF |
Product Overview : | Human CALY full-length ORF (AAH38978.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 217 amino acids |
Description : | The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.27 kDa |
AA Sequence : | MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CALY calcyon neuron-specific vesicular protein [ Homo sapiens ] |
Official Symbol | CALY |
Synonyms | CALY; calcyon neuron-specific vesicular protein; dopamine receptor D1 interacting protein, DRD1IP; neuron-specific vesicular protein calcyon; CALCYON; NSG3; calcyon protein; D1 dopamine receptor-interacting protein; dopamine receptor D1 interacting protein; calcyon D1 dopamine receptor-interacting protein (CALCYON); DRD1IP; RP11-122K13.5; |
Gene ID | 50632 |
mRNA Refseq | NM_015722 |
Protein Refseq | NP_056537 |
MIM | 604647 |
UniProt ID | Q9NYX4 |
◆ Recombinant Proteins | ||
CALY-1195M | Recombinant Mouse CALY Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL20361RF | Recombinant Full Length Rat Neuron-Specific Vesicular Protein Calcyon(Caly) Protein, His-Tagged | +Inquiry |
CALY-3083HF | Recombinant Full Length Human CALY Protein, GST-tagged | +Inquiry |
CALY-612R | Recombinant Rhesus monkey CALY Protein, His-tagged | +Inquiry |
Caly-1101M | Recombinant Mouse Caly protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CALY Products
Required fields are marked with *
My Review for All CALY Products
Required fields are marked with *