Recombinant Full Length Human CAMLG Protein, GST-tagged
| Cat.No. : | CAMLG-2794HF |
| Product Overview : | Human CAMLG full-length ORF (NP_001736.1, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 296 amino acids |
| Description : | The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 59.4 kDa |
| AA Sequence : | MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CAMLG calcium modulating ligand [ Homo sapiens ] |
| Official Symbol | CAMLG |
| Synonyms | CAMLG; calcium modulating ligand; calcium signal-modulating cyclophilin ligand; calcium modulating cyclophilin ligand; calcium signal modulating cyclophilin ligand; CAML; cyclophilin B binding protein; cyclophilin B-binding protein; calcium-modulating cyclophilin ligand; calcium-signal modulating cyclophilin ligand; MGC163197; |
| Gene ID | 819 |
| mRNA Refseq | NM_001745 |
| Protein Refseq | NP_001736 |
| MIM | 601118 |
| UniProt ID | P49069 |
| ◆ Recombinant Proteins | ||
| CAMLG-2794HF | Recombinant Full Length Human CAMLG Protein, GST-tagged | +Inquiry |
| CAMLG-1925H | Recombinant Human CAMLG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CAMLG-10690H | Recombinant Human CAMLG, GST-tagged | +Inquiry |
| Caml-583M | Recombinant Mouse Caml Protein, His-tagged | +Inquiry |
| CAMLG-618R | Recombinant Rhesus monkey CAMLG Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CAMLG-7872HCL | Recombinant Human CAMLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CAMLG Products
Required fields are marked with *
My Review for All CAMLG Products
Required fields are marked with *
