Recombinant Full Length Human CAP1 Protein, C-Flag-tagged
Cat.No. : | CAP1-622HFL |
Product Overview : | Recombinant Full Length Human CAP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.5 kDa |
AA Sequence : | MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQ KHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFREKNRGSKLFNHLSAVSESIQA LGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHVDWVKAYLSIWTELQAYIKEFHTTGLAWSKT GPVAKELSGLPSGPSAGSGPPPPPPGPPPPPVSTSSGSDESASRSALFAQINQGESITHALKHVSDDMKT HKNPALKAQSGPVRSGPKPFSAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQV AYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | CAP1 cyclase associated actin cytoskeleton regulatory protein 1 [ Homo sapiens (human) ] |
Official Symbol | CAP1 |
Synonyms | CAP; CAP1-PEN |
Gene ID | 10487 |
mRNA Refseq | NM_006367.4 |
Protein Refseq | NP_006358.2 |
MIM | 617801 |
UniProt ID | Q01518 |
◆ Recombinant Proteins | ||
CAP1-0692H | Recombinant Human CAP1 Protein (Lys317-Glu455), N-His tagged | +Inquiry |
Cap1-447R | Recombinant Rat Cap1 Protein, His/GST-tagged | +Inquiry |
CAP1-0351H | Recombinant Human CAP1 Protein, GST-Tagged | +Inquiry |
CAP1-445H | Recombinant Human CAP1 Protein, His-tagged | +Inquiry |
CAP1-3191H | Recombinant Human CAP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAP1-7868HCL | Recombinant Human CAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Protein size is 51.5 kDa. But, Image shows two bands including that band and smaller one. What is the smaller band in Coomassie blue staining image?
CAP1-622HFL
10/02/2024
Thank you for your interest in our CAP1 product. The two bands might be caused by alternative splicing during the post-translational modification process.
Ask a Question for All CAP1 Products
Required fields are marked with *
My Review for All CAP1 Products
Required fields are marked with *
0
Inquiry Basket