Recombinant Full Length Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3(Ceacam3) Protein, His-Tagged
Cat.No. : | RFL16169HF |
Product Overview : | Recombinant Full Length Human Carcinoembryonic antigen-related cell adhesion molecule 3(CEACAM3) Protein (P40198) (35-252aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (35-252) |
Form : | Lyophilized powder |
AA Sequence : | KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CEACAM3 |
Synonyms | carcinoembryonic ; Carcinoembryonic antigen CGM1; Carcinoembryonic antigen gene family member 1; carcinoembryonic antigen related cell adhesion molecule 3; Carcinoembryonic antigen-related cell adhesion molecule 3; cd66 d; CD66d; CD66d antigen; CEA; CEACA |
UniProt ID | P40198 |
◆ Recombinant Proteins | ||
RFL16169HF | Recombinant Full Length Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3(Ceacam3) Protein, His-Tagged | +Inquiry |
CEACAM3-3192H | Recombinant Human CEACAM3 Protein, MYC/DDK-tagged | +Inquiry |
Ceacam3-8195R | Recombinant Rat Ceacam3 protein, His-tagged | +Inquiry |
CEACAM3-676H | Recombinant Human carcinoembryonic antigen-related cell adhesion molecule 3, His-tagged | +Inquiry |
CEACAM3-2698H | Recombinant Human CEACAM3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM3-2074HCL | Recombinant Human CEACAM3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM3 Products
Required fields are marked with *
My Review for All CEACAM3 Products
Required fields are marked with *
0
Inquiry Basket