Recombinant Full Length Human CARD16 Protein, GST-tagged
Cat.No. : | CARD16-1950HF |
Product Overview : | Human COP1 full-length ORF ( NP_443121.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 97 amino acids |
Description : | CARD16 (Caspase Recruitment Domain Family Member 16) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD17. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVLNQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAETLGLSAGPIPGN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARD16 caspase recruitment domain family, member 16 [ Homo sapiens ] |
Official Symbol | CARD16 |
Synonyms | CARD16; caspase recruitment domain family, member 16; caspase recruitment domain-containing protein 16; COP; COP1; PSEUDO ICE; CARD only protein; caspase-1 inhibitor COP; CARD only domain-containing protein 1; pseudo interleukin-1beta converting enzyme; pseudo interleukin-1 beta converting enzyme; caspase-1 dominant-negative inhibitor pseudo-ICE; PSEUDO-ICE |
Gene ID | 114769 |
mRNA Refseq | NM_001017534 |
Protein Refseq | NP_001017534 |
MIM | 615680 |
UniProt ID | Q5EG05 |
◆ Recombinant Proteins | ||
CARD16-6035H | Recombinant Human CARD16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CARD16-2523H | Recombinant Human CARD16 Protein, His-tagged | +Inquiry |
CARD16-1950HF | Recombinant Full Length Human CARD16 Protein, GST-tagged | +Inquiry |
CARD16-1690H | Recombinant Human CARD16 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARD16-7849HCL | Recombinant Human CARD16 293 Cell Lysate | +Inquiry |
CARD16-7848HCL | Recombinant Human CARD16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARD16 Products
Required fields are marked with *
My Review for All CARD16 Products
Required fields are marked with *