Recombinant Full Length Human CARD17 Protein, GST-tagged
Cat.No. : | CARD17-5869HF |
Product Overview : | Human INCA full-length ORF ( NP_001007233.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 110 amino acids |
Description : | CARD17 (Caspase Recruitment Domain Family Member 17) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD16. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARD17 caspase recruitment domain family, member 17 [ Homo sapiens ] |
Official Symbol | CARD17 |
Synonyms | CARD17; caspase recruitment domain family, member 17; caspase recruitment domain-containing protein 17; INCA; Inhibitory CARD; caspase-1 inhibitor INCA; inhibitory caspase recruitment domain protein; inhibitory caspase recruitment domain (CARD) protein; |
Gene ID | 440068 |
mRNA Refseq | NM_001007232 |
Protein Refseq | NP_001007233 |
MIM | 609490 |
UniProt ID | Q5XLA6 |
◆ Recombinant Proteins | ||
CARD17-2311H | Recombinant Human CARD17 protein, His-tagged | +Inquiry |
CARD17-2522H | Recombinant Human CARD17 Protein, MYC/DDK-tagged | +Inquiry |
CARD17-2861H | Recombinant Human CARD17 protein(1-110aa), His&Myc-tagged | +Inquiry |
CARD17-5485H | Recombinant Human CARD17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CARD17-5135H | Recombinant Human CARD17 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARD17-859HCL | Recombinant Human CARD17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARD17 Products
Required fields are marked with *
My Review for All CARD17 Products
Required fields are marked with *
0
Inquiry Basket