Recombinant Full Length Human CARD17 Protein, GST-tagged

Cat.No. : CARD17-5869HF
Product Overview : Human INCA full-length ORF ( NP_001007233.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 110 amino acids
Description : CARD17 (Caspase Recruitment Domain Family Member 17) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD16.
Molecular Mass : 38.3 kDa
AA Sequence : MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CARD17 caspase recruitment domain family, member 17 [ Homo sapiens ]
Official Symbol CARD17
Synonyms CARD17; caspase recruitment domain family, member 17; caspase recruitment domain-containing protein 17; INCA; Inhibitory CARD; caspase-1 inhibitor INCA; inhibitory caspase recruitment domain protein; inhibitory caspase recruitment domain (CARD) protein;
Gene ID 440068
mRNA Refseq NM_001007232
Protein Refseq NP_001007233
MIM 609490
UniProt ID Q5XLA6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CARD17 Products

Required fields are marked with *

My Review for All CARD17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon