Recombinant Full Length Human CARNMT1 Protein, C-Flag-tagged
Cat.No. : | CARNMT1-1716HFL |
Product Overview : | Recombinant Full Length Human CARNMT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a methyltransferase that converts carnosine to anserine, a dipeptide found abundantly in skeletal muscle. The encoded protein can methylate other dipeptides as well. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47 kDa |
AA Sequence : | MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKII NAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYG EDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAG LGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDP HSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFEN LANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CARNMT1 carnosine N-methyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | CARNMT1 |
Synonyms | C9orf41; UPF0586 |
Gene ID | 138199 |
mRNA Refseq | NM_152420.3 |
Protein Refseq | NP_689633.1 |
MIM | 616552 |
UniProt ID | Q8N4J0 |
◆ Recombinant Proteins | ||
CARNMT1-2707HF | Recombinant Full Length Human CARNMT1 Protein, GST-tagged | +Inquiry |
Carnmt1-1103M | Recombinant Mouse Carnmt1 protein, His-SUMO-tagged | +Inquiry |
CARNMT1-504H | Recombinant Human CARNMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CARNMT1-2526H | Recombinant Human CARNMT1 Protein, MYC/DDK-tagged | +Inquiry |
CARNMT1-1716HFL | Recombinant Full Length Human CARNMT1 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARNMT1 Products
Required fields are marked with *
My Review for All CARNMT1 Products
Required fields are marked with *