Recombinant Full Length Human CARNMT1 Protein, C-Flag-tagged
| Cat.No. : | CARNMT1-1716HFL |
| Product Overview : | Recombinant Full Length Human CARNMT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a methyltransferase that converts carnosine to anserine, a dipeptide found abundantly in skeletal muscle. The encoded protein can methylate other dipeptides as well. Three transcript variants encoding two different isoforms have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 47 kDa |
| AA Sequence : | MQRRRRPPPPTSRLPEGCGGGGGGSEEVEVQFSAGRWGSAAAVSAAAAAATRSTEEEEERLEREHFWKII NAFRYYGTSMHERVNRTERQFRSLPANQQKLLPQFLLHLDKIRKCIDHNQEILLTIVNDCIHMFENKEYG EDGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKNFPKERWDPSKVNILVPGAG LGRLAWEIAMLGYACQGNEWSFFMLFSSNFVLNRCSEINKYKLYPWIHQFSNNRRSADQIRPIFFPDVDP HSLPPGSNFSMTAGDFQEIYSECNTWDCIATCFFIDTAHNVIDYIDTIWKILKPGGIWINLGPLLYHFEN LANELSIELSYEDIKNVVLQYGFKVEVEKESVLSTYTVNDLSMMKYYYECVLFVVRKPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CARNMT1 carnosine N-methyltransferase 1 [ Homo sapiens (human) ] |
| Official Symbol | CARNMT1 |
| Synonyms | C9orf41; UPF0586 |
| Gene ID | 138199 |
| mRNA Refseq | NM_152420.3 |
| Protein Refseq | NP_689633.1 |
| MIM | 616552 |
| UniProt ID | Q8N4J0 |
| ◆ Recombinant Proteins | ||
| CARNMT1-5621H | Recombinant Human CARNMT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Carnmt1-1409M | Recombinant Mouse Carnmt1 Protein, Myc/DDK-tagged | +Inquiry |
| CARNMT1-2707HF | Recombinant Full Length Human CARNMT1 Protein, GST-tagged | +Inquiry |
| CARNMT1-2526H | Recombinant Human CARNMT1 Protein, MYC/DDK-tagged | +Inquiry |
| Carnmt1-1103M | Recombinant Mouse Carnmt1 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CARNMT1 Products
Required fields are marked with *
My Review for All CARNMT1 Products
Required fields are marked with *
