Recombinant Full Length Human CCDC12 Protein, GST-tagged
| Cat.No. : | CCDC12-2830HF |
| Product Overview : | Human CCDC12 full-length ORF (NP_653317.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 166 amino acids |
| Description : | CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway. |
| Molecular Mass : | 45.6 kDa |
| AA Sequence : | MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCDC12 coiled-coil domain containing 12 [ Homo sapiens ] |
| Official Symbol | CCDC12 |
| Synonyms | CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801; |
| Gene ID | 151903 |
| mRNA Refseq | NM_144716 |
| Protein Refseq | NP_653317 |
| UniProt ID | Q8WUD4 |
| ◆ Recombinant Proteins | ||
| Ccdc12-1987M | Recombinant Mouse Ccdc12 Protein, Myc/DDK-tagged | +Inquiry |
| CCDC12-0517H | Recombinant Human CCDC12 Protein, GST-Tagged | +Inquiry |
| CCDC12-10786H | Recombinant Human CCDC12, GST-tagged | +Inquiry |
| CCDC12-2363H | Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CCDC12-1016Z | Recombinant Zebrafish CCDC12 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC12-7785HCL | Recombinant Human CCDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC12 Products
Required fields are marked with *
My Review for All CCDC12 Products
Required fields are marked with *


