Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CCDC12-2363H
• Product Overview: CCDC12 MS Standard C13 and N15-labeled recombinant protein (NP_653317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Diseases associated with CCDC12 include Gray Platelet Syndrome. Among its related pathways are mRNA Splicing - Major Pathway.
• Molecular Mass: 19.2 kDa
• AA Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CCDC12 coiled-coil domain containing 12 [ Homo sapiens (human) ]
• Official Symbol: CCDC12
• Synonyms: CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801
• Gene ID: 151903
• mRNA Refseq: NM_144716
• Protein Refseq: NP_653317
• UniProt ID: Q8WUD4