Recombinant Full Length Human CCDC130 Protein, GST-tagged
Cat.No. : | CCDC130-2835HF |
Product Overview : | Human CCDC130 full-length ORF (NP_110445.1, 1 a.a. - 396 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 396 amino acids |
Description : | CCDC130 (Coiled-Coil Domain Containing 130) is a Protein Coding gene. Diseases associated with CCDC130 include Trench Fever and Phlebotomus Fever. Among its related pathways are Ectoderm Differentiation. An important paralog of this gene is CCDC94. |
Molecular Mass : | 71.2 kDa |
AA Sequence : | MGERKGVNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDMADNEQVLTTEHEKKQKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQSAWKDDFALNSMLRRRFREKKKAIQEEEERDQALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALATSPITVGDLGIVRRRSRDVPESPQHAADTPKSGEPRVPEEAAQDRPMSPGDCPPETTETPKCSSPRGQEGSRQDKPLSPAGSSQEAADTPDTRHPCSLGSSLVADYSDSESE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC130 coiled-coil domain containing 130 [ Homo sapiens ] |
Official Symbol | CCDC130 |
Synonyms | coiled-coil domain containing 130; 9 kDa protein; MGC10471; coiled-coil domain-containing protein 130 |
Gene ID | 81576 |
mRNA Refseq | NM_030818 |
Protein Refseq | NP_110445 |
UniProt ID | P13994 |
◆ Recombinant Proteins | ||
CCDC130-2835HF | Recombinant Full Length Human CCDC130 Protein, GST-tagged | +Inquiry |
CCDC130-1173R | Recombinant Rat CCDC130 Protein | +Inquiry |
Ccdc130-1990M | Recombinant Mouse Ccdc130 Protein, Myc/DDK-tagged | +Inquiry |
CCDC130-4625H | Recombinant Human CCDC130 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC130-0523H | Recombinant Human CCDC130 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC130-7780HCL | Recombinant Human CCDC130 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC130 Products
Required fields are marked with *
My Review for All CCDC130 Products
Required fields are marked with *