Recombinant Full Length Human CCDC148 Protein, GST-tagged

• Cat.No.: CCDC148-2840HF
• Product Overview: Human CCDC148 full-length ORF (AAH15395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 255 amino acids
• Description: CCDC148 (Coiled-Coil Domain Containing 148) is a Protein Coding gene.
• Molecular Mass: 56.7 kDa
• AA Sequence: MCAASASPDNLVFHMKNEMRNIKYKPVDYQQLRALTEAKKLASASAKLKIRKAMLTSKLSKEQTLIKQHKQVWWQEYQRLNEVRCKMESEIKSLLNEENIGNECLCDLTNFEQELSEQQCTYLKNVINPIQQLRADLKYRQHHTLQHSHPHIEFNSVKVLEEVDFVKKQLKTVFERLRLEQQRIENDLSDWSIKILDHSLEEKTNPLSELPIELESLECPYPDLKSSILSEFYKFTQKYQKKLQDFNLQLEDIYR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC148 coiled-coil domain containing 148 [ Homo sapiens ]
• Official Symbol: CCDC148
• Synonyms: CCDC148; coiled-coil domain containing 148; coiled-coil domain-containing protein 148; MGC125588; MGC125590
• Gene ID: 130940
• mRNA Refseq: NM_001171637
• Protein Refseq: NP_001165108
• UniProt ID: Q8NFR7