Recombinant Full Length Human CCDC148 Protein, GST-tagged
Cat.No. : | CCDC148-2840HF |
Product Overview : | Human CCDC148 full-length ORF (AAH15395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 255 amino acids |
Description : | CCDC148 (Coiled-Coil Domain Containing 148) is a Protein Coding gene. |
Molecular Mass : | 56.7 kDa |
AA Sequence : | MCAASASPDNLVFHMKNEMRNIKYKPVDYQQLRALTEAKKLASASAKLKIRKAMLTSKLSKEQTLIKQHKQVWWQEYQRLNEVRCKMESEIKSLLNEENIGNECLCDLTNFEQELSEQQCTYLKNVINPIQQLRADLKYRQHHTLQHSHPHIEFNSVKVLEEVDFVKKQLKTVFERLRLEQQRIENDLSDWSIKILDHSLEEKTNPLSELPIELESLECPYPDLKSSILSEFYKFTQKYQKKLQDFNLQLEDIYR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC148 coiled-coil domain containing 148 [ Homo sapiens ] |
Official Symbol | CCDC148 |
Synonyms | CCDC148; coiled-coil domain containing 148; coiled-coil domain-containing protein 148; MGC125588; MGC125590; |
Gene ID | 130940 |
mRNA Refseq | NM_001171637 |
Protein Refseq | NP_001165108 |
UniProt ID | Q8NFR7 |
◆ Recombinant Proteins | ||
CCDC148-2840HF | Recombinant Full Length Human CCDC148 Protein, GST-tagged | +Inquiry |
CCDC148-0531H | Recombinant Human CCDC148 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC148-998HCL | Recombinant Human CCDC148 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC148 Products
Required fields are marked with *
My Review for All CCDC148 Products
Required fields are marked with *
0
Inquiry Basket