Recombinant Full Length Human CCDC28B Protein, GST-tagged

Cat.No. : CCDC28B-2856HF
Product Overview : Human CCDC28B full-length ORF (NP_077272.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 200 amino acids
Description : The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 48.4 kDa
AA Sequence : MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC28B coiled-coil domain containing 28B [ Homo sapiens ]
Official Symbol CCDC28B
Synonyms CCDC28B; coiled-coil domain containing 28B; coiled-coil domain-containing protein 28B; MGC1203; RP4 622L5.5; RP4-622L5.5; MGC16441;
Gene ID 79140
mRNA Refseq NM_024296
Protein Refseq NP_077272
MIM 610162
UniProt ID Q9BUN5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC28B Products

Required fields are marked with *

My Review for All CCDC28B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon