Recombinant Full Length Human CCDC28B Protein, GST-tagged
Cat.No. : | CCDC28B-2856HF |
Product Overview : | Human CCDC28B full-length ORF (NP_077272.2, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 200 amino acids |
Description : | The product of this gene localizes to centrosomes and basal bodies. The protein colocalizes with several proteins associated with Bardet-Biedl syndrome (BBS) and participates in the regulation of cilia development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC28B coiled-coil domain containing 28B [ Homo sapiens ] |
Official Symbol | CCDC28B |
Synonyms | CCDC28B; coiled-coil domain containing 28B; coiled-coil domain-containing protein 28B; MGC1203; RP4 622L5.5; RP4-622L5.5; MGC16441; |
Gene ID | 79140 |
mRNA Refseq | NM_024296 |
Protein Refseq | NP_077272 |
MIM | 610162 |
UniProt ID | Q9BUN5 |
◆ Recombinant Proteins | ||
CCDC28B-2856HF | Recombinant Full Length Human CCDC28B Protein, GST-tagged | +Inquiry |
CCDC28B-2883M | Recombinant Mouse CCDC28B Protein | +Inquiry |
CCDC28B-0543H | Recombinant Human CCDC28B Protein, GST-Tagged | +Inquiry |
Ccdc28b-2003M | Recombinant Mouse Ccdc28b Protein, Myc/DDK-tagged | +Inquiry |
CCDC28B-1334M | Recombinant Mouse CCDC28B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC28B-7767HCL | Recombinant Human CCDC28B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC28B Products
Required fields are marked with *
My Review for All CCDC28B Products
Required fields are marked with *