Recombinant Full Length Human CCDC38 Protein, GST-tagged

Cat.No. : CCDC38-2861HF
Product Overview : Human CCDC38 full-length ORF (AAH95479.1, 1 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 563 amino acids
Description : CCDC38 (Coiled-Coil Domain Containing 38) is a Protein Coding gene. An important paralog of this gene is CFAP100.
Molecular Mass : 91.7 kDa
AA Sequence : MSSNLLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPAPIPRLIEGSDTKRTVHEFINDQRDRFLLEYALSTKRNTIKKFEKDIAMRERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAELKKASMEVQAVKSEIAKTEFLLREYMKYGFFLLQMSPKHWQIQQALKRAQASKSKANIILPKILAKLSLHSSNKEGILEESGRTAVLSEDASQGRDSQGKPSRSLTRTPEKKKSNLAESFGSEDSLEFLLDDEMDVDLEPALYFKEPEELLQVLRELEEQNLTLFQYSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEKMLKANCVREEEKAAELQLKSKLFSFGEFNSDAQEILIDSLSKKITQVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPKENVEAIERMKQKEWRQKFRDEKMKEKQRHQQERLKAALEKAVAQPKKKLGRRLVFHSKPPSGNKQQLPLVNETKTKSQEEEYFFT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC38 coiled-coil domain containing 38 [ Homo sapiens ]
Official Symbol CCDC38
Synonyms CCDC38; coiled-coil domain containing 38; coiled-coil domain-containing protein 38; FLJ40089;
Gene ID 120935
mRNA Refseq NM_182496
Protein Refseq NP_872302
UniProt ID Q502W7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCDC38 Products

Required fields are marked with *

My Review for All CCDC38 Products

Required fields are marked with *

0
cart-icon