Recombinant Full Length Human CCDC38 Protein, GST-tagged
Cat.No. : | CCDC38-2861HF |
Product Overview : | Human CCDC38 full-length ORF (AAH95479.1, 1 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 563 amino acids |
Description : | CCDC38 (Coiled-Coil Domain Containing 38) is a Protein Coding gene. An important paralog of this gene is CFAP100. |
Molecular Mass : | 91.7 kDa |
AA Sequence : | MSSNLLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPAPIPRLIEGSDTKRTVHEFINDQRDRFLLEYALSTKRNTIKKFEKDIAMRERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAELKKASMEVQAVKSEIAKTEFLLREYMKYGFFLLQMSPKHWQIQQALKRAQASKSKANIILPKILAKLSLHSSNKEGILEESGRTAVLSEDASQGRDSQGKPSRSLTRTPEKKKSNLAESFGSEDSLEFLLDDEMDVDLEPALYFKEPEELLQVLRELEEQNLTLFQYSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEKMLKANCVREEEKAAELQLKSKLFSFGEFNSDAQEILIDSLSKKITQVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPKENVEAIERMKQKEWRQKFRDEKMKEKQRHQQERLKAALEKAVAQPKKKLGRRLVFHSKPPSGNKQQLPLVNETKTKSQEEEYFFT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC38 coiled-coil domain containing 38 [ Homo sapiens ] |
Official Symbol | CCDC38 |
Synonyms | CCDC38; coiled-coil domain containing 38; coiled-coil domain-containing protein 38; FLJ40089; |
Gene ID | 120935 |
mRNA Refseq | NM_182496 |
Protein Refseq | NP_872302 |
UniProt ID | Q502W7 |
◆ Recombinant Proteins | ||
CCDC38-2861HF | Recombinant Full Length Human CCDC38 Protein, GST-tagged | +Inquiry |
CCDC38-2890M | Recombinant Mouse CCDC38 Protein | +Inquiry |
CCDC38-1337M | Recombinant Mouse CCDC38 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC38-0548H | Recombinant Human CCDC38 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC38 Products
Required fields are marked with *
My Review for All CCDC38 Products
Required fields are marked with *