Recombinant Full Length Human CCDC38 Protein, GST-tagged
| Cat.No. : | CCDC38-2861HF | 
| Product Overview : | Human CCDC38 full-length ORF (AAH95479.1, 1 a.a. - 563 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 563 amino acids | 
| Description : | CCDC38 (Coiled-Coil Domain Containing 38) is a Protein Coding gene. An important paralog of this gene is CFAP100. | 
| Molecular Mass : | 91.7 kDa | 
| AA Sequence : | MSSNLLPTLNSGGKVKDGSTKEDRPYKIFFRDLFLVKENEMAAKETEKFMNRNMKVYQKTTFSSRMKSHSYLSQLAFYPKRSGRSFEKFGPGPAPIPRLIEGSDTKRTVHEFINDQRDRFLLEYALSTKRNTIKKFEKDIAMRERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAELKKASMEVQAVKSEIAKTEFLLREYMKYGFFLLQMSPKHWQIQQALKRAQASKSKANIILPKILAKLSLHSSNKEGILEESGRTAVLSEDASQGRDSQGKPSRSLTRTPEKKKSNLAESFGSEDSLEFLLDDEMDVDLEPALYFKEPEELLQVLRELEEQNLTLFQYSQDVDENLEEVNKREKVIQDKTNSNIEFLLEQEKMLKANCVREEEKAAELQLKSKLFSFGEFNSDAQEILIDSLSKKITQVYKVCIGDAEDDGLNPIQKLVKVESRLVELCDLIESIPKENVEAIERMKQKEWRQKFRDEKMKEKQRHQQERLKAALEKAVAQPKKKLGRRLVFHSKPPSGNKQQLPLVNETKTKSQEEEYFFT | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CCDC38 coiled-coil domain containing 38 [ Homo sapiens ] | 
| Official Symbol | CCDC38 | 
| Synonyms | CCDC38; coiled-coil domain containing 38; coiled-coil domain-containing protein 38; FLJ40089; | 
| Gene ID | 120935 | 
| mRNA Refseq | NM_182496 | 
| Protein Refseq | NP_872302 | 
| UniProt ID | Q502W7 | 
| ◆ Recombinant Proteins | ||
| CCDC38-2890M | Recombinant Mouse CCDC38 Protein | +Inquiry | 
| CCDC38-0548H | Recombinant Human CCDC38 Protein, GST-Tagged | +Inquiry | 
| CCDC38-2861HF | Recombinant Full Length Human CCDC38 Protein, GST-tagged | +Inquiry | 
| CCDC38-1337M | Recombinant Mouse CCDC38 Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC38 Products
Required fields are marked with *
My Review for All CCDC38 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            