Recombinant Full Length Human CCDC86 Protein, GST-tagged

Cat.No. : CCDC86-2900HF
Product Overview : Human CCDC86 full-length ORF (NP_077003.1, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 360 amino acids
Description : CCDC86 (Coiled-Coil Domain Containing 86) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
Molecular Mass : 66.6 kDa
AA Sequence : MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC86 coiled-coil domain containing 86 [ Homo sapiens ]
Official Symbol CCDC86
Synonyms CCDC86; coiled-coil domain containing 86; coiled-coil domain-containing protein 86; MGC2574; cyclon; cytokine-induced protein with coiled-coil domain; FLJ22321;
Gene ID 79080
mRNA Refseq NM_024098
Protein Refseq NP_077003
MIM 611293
UniProt ID Q9H6F5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC86 Products

Required fields are marked with *

My Review for All CCDC86 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon