Recombinant Full Length Human CCDC86 Protein, GST-tagged
Cat.No. : | CCDC86-2900HF |
Product Overview : | Human CCDC86 full-length ORF (NP_077003.1, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 360 amino acids |
Description : | CCDC86 (Coiled-Coil Domain Containing 86) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding. |
Molecular Mass : | 66.6 kDa |
AA Sequence : | MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC86 coiled-coil domain containing 86 [ Homo sapiens ] |
Official Symbol | CCDC86 |
Synonyms | CCDC86; coiled-coil domain containing 86; coiled-coil domain-containing protein 86; MGC2574; cyclon; cytokine-induced protein with coiled-coil domain; FLJ22321; |
Gene ID | 79080 |
mRNA Refseq | NM_024098 |
Protein Refseq | NP_077003 |
MIM | 611293 |
UniProt ID | Q9H6F5 |
◆ Recombinant Proteins | ||
CCDC86-858R | Recombinant Rat CCDC86 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC86-0587H | Recombinant Human CCDC86 Protein, GST-Tagged | +Inquiry |
CCDC86-2900HF | Recombinant Full Length Human CCDC86 Protein, GST-tagged | +Inquiry |
CCDC86-2938M | Recombinant Mouse CCDC86 Protein | +Inquiry |
CCDC86-673R | Recombinant Rhesus monkey CCDC86 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC86-162HCL | Recombinant Human CCDC86 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC86 Products
Required fields are marked with *
My Review for All CCDC86 Products
Required fields are marked with *