Recombinant Full Length Human CCDC92 Protein, C-Flag-tagged
Cat.No. : | CCDC92-2011HFL |
Product Overview : | Recombinant Full Length Human CCDC92 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Located in centriole; centrosome; and nucleoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKS SEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLENTIKEREKKYLEELKAKSHK LTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASPSGSPVLASYKPAPPKDKLPETPRRRMKKSL SAPLHPEFEEVYRFGAESRKLLLREPVDAMPDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPA REKPHKAHVGVAHRIHHATPPQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CCDC92 coiled-coil domain containing 92 [ Homo sapiens (human) ] |
Official Symbol | CCDC92 |
Synonyms | FLJ22471 |
Gene ID | 80212 |
mRNA Refseq | NM_025140.3 |
Protein Refseq | NP_079416.1 |
UniProt ID | Q53HC0 |
◆ Recombinant Proteins | ||
CCDC92-2011HFL | Recombinant Full Length Human CCDC92 Protein, C-Flag-tagged | +Inquiry |
CCDC92-518H | Recombinant Human CCDC92 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC92-0594H | Recombinant Human CCDC92 Protein, GST-Tagged | +Inquiry |
CCDC92-2948M | Recombinant Mouse CCDC92 Protein | +Inquiry |
CCDC92-1383M | Recombinant Mouse CCDC92 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC92-164HCL | Recombinant Human CCDC92 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC92 Products
Required fields are marked with *
My Review for All CCDC92 Products
Required fields are marked with *
0
Inquiry Basket