Recombinant Full Length Human CCDC92 Protein, C-Flag-tagged
| Cat.No. : | CCDC92-2011HFL |
| Product Overview : | Recombinant Full Length Human CCDC92 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables identical protein binding activity. Located in centriole; centrosome; and nucleoplasm. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 36.8 kDa |
| AA Sequence : | MTSPHFSSYDEGPLDVSMAATNLENQLHSAQKNLLFLQREHASTLKGLHSEIRRLQQHCTDLTYELTVKS SEQTGDGTSKSSELKKRCEELEAQLKVKENENAELLKELEQKNAMITVLENTIKEREKKYLEELKAKSHK LTLLSSELEQRASTIAYLTSQLHAAKKKLMSSSGTSDASPSGSPVLASYKPAPPKDKLPETPRRRMKKSL SAPLHPEFEEVYRFGAESRKLLLREPVDAMPDPTPFLLARESAEVHLIKERPLVIPPIASDRSGEQHSPA REKPHKAHVGVAHRIHHATPPQAQPEVKTLAVDQVNGGKVVRKHSGTDRTV myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CCDC92 coiled-coil domain containing 92 [ Homo sapiens (human) ] |
| Official Symbol | CCDC92 |
| Synonyms | FLJ22471 |
| Gene ID | 80212 |
| mRNA Refseq | NM_025140.3 |
| Protein Refseq | NP_079416.1 |
| UniProt ID | Q53HC0 |
| ◆ Recombinant Proteins | ||
| CCDC92-2909HF | Recombinant Full Length Human CCDC92 Protein, GST-tagged | +Inquiry |
| CCDC92-3597Z | Recombinant Zebrafish CCDC92 | +Inquiry |
| Ccdc92-2023M | Recombinant Mouse Ccdc92 Protein, Myc/DDK-tagged | +Inquiry |
| CCDC92-2948M | Recombinant Mouse CCDC92 Protein | +Inquiry |
| CCDC92-2075H | Recombinant Human CCDC92 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCDC92-164HCL | Recombinant Human CCDC92 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCDC92 Products
Required fields are marked with *
My Review for All CCDC92 Products
Required fields are marked with *



