Recombinant Full Length Human CCL3L1 Protein, GST-tagged
Cat.No. : | CCL3L1-2952HF |
Product Overview : | Human CCL3L1 full-length ORF (AAH27888.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 93 amino acids |
Description : | This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this gene binds to several chemokine receptors, including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The copy number of this gene varies among individuals, where most individuals have one to six copies, and a minority of individuals have zero or more than six copies. There are conflicting reports about copy number variation of this gene and its correlation to disease susceptibility. This record represents one of two copies that are present on the ALT_REF_LOCI_2 alternate haplotype of the GRCh38 human reference genome assembly. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 35.97 kDa |
AA Sequence : | MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL3L1 chemokine (C-C motif) ligand 3-like 1 [ Homo sapiens ] |
Official Symbol | CCL3L1 |
Synonyms | CCL3L1; chemokine (C-C motif) ligand 3-like 1; D17S1718, SCYA3L, SCYA3L1, small inducible cytokine A3 like 1; C-C motif chemokine 3-like 1; G0S19 2; LD78BETA; PAT 464.2; LD78-beta(1-70); small inducible cytokine A3-like 1; small-inducible cytokine A3-like 1; G0/G1 switch regulatory protein 19-2; tonsillar lymphocyte LD78 beta protein; LD78; 464.2; MIP1AP; SCYA3L; G0S19-2; SCYA3L1; D17S1718; MGC12815; MGC104178; MGC182017; |
Gene ID | 6349 |
mRNA Refseq | NM_021006 |
Protein Refseq | NP_066286 |
MIM | 601395 |
UniProt ID | P16619 |
◆ Recombinant Proteins | ||
CCL3L1-606H | Recombinant Human CCL3L1 protein | +Inquiry |
CCL3L1-145S | Recombinant Swine Chemokine (C-C motif) Ligand 3-like 1 | +Inquiry |
CCL3L1-165H | Recombinant Human CCL3L1, His-tagged | +Inquiry |
CCL3L1-4028H | Recombinant Human CCL3L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL3L1-1234H | Recombinant Human CCL3L1 Protein (Ala24-Ala93), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3L1-7722HCL | Recombinant Human CCL3L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL3L1 Products
Required fields are marked with *
My Review for All CCL3L1 Products
Required fields are marked with *
0
Inquiry Basket