Recombinant Full Length Human CCL4L1 Protein, GST-tagged

Cat.No. : CCL4L1-2953HF
Product Overview : Human CCL4L1 full-length ORF (AAI48785.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 92 amino acids
Description : This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Molecular Mass : 37.07 kDa
AA Sequence : MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL4L1 chemokine (C-C motif) ligand 4-like 1 [ Homo sapiens ]
Official Symbol CCL4L1
Synonyms CCL4L1; chemokine (C-C motif) ligand 4-like 1; CCL4L, chemokine (C C motif) ligand 4 like, SCYA4L, small inducible cytokine A4 like; C-C motif chemokine 4-like; AT744.2; LAG 1; MIP-1-beta; macrophage inflammatory protein-1b2; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; monocyte adherence-induced protein 5-alpha; LAG1; CCL4L; LAG-1; SCYA4L;
Gene ID 388372
mRNA Refseq NM_001001435
Protein Refseq NP_001001435
MIM 603782
UniProt ID Q8NHW4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL4L1 Products

Required fields are marked with *

My Review for All CCL4L1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon