Recombinant Full Length Human CCNA1 Protein, GST-tagged
Cat.No. : | CCNA1-2957HF |
Product Overview : | Human CCNA1 full-length ORF (AAH36346, 1 a.a. - 464 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 464 amino acids |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 76.78 kDa |
AA Sequence : | METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNA1 cyclin A1 [ Homo sapiens ] |
Official Symbol | CCNA1 |
Synonyms | CCNA1; cyclin A1; cyclin-A1; |
Gene ID | 8900 |
mRNA Refseq | NM_001111045 |
Protein Refseq | NP_001104515 |
MIM | 604036 |
UniProt ID | P78396 |
◆ Recombinant Proteins | ||
CCNA1-186H | Recombinant Human CCNA1 protein, GST/His-tagged | +Inquiry |
CCNA1-1217R | Recombinant Rat CCNA1 Protein | +Inquiry |
CCNA1-2205H | Recombinant Human CCNA1 protein, His-tagged | +Inquiry |
CCNA1-0647H | Recombinant Human CCNA1 Protein, GST-Tagged | +Inquiry |
CCNA1-31591TH | Recombinant Human Human CDK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNA1-682HCL | Recombinant Human CCNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNA1 Products
Required fields are marked with *
My Review for All CCNA1 Products
Required fields are marked with *