Recombinant Full Length Human CCNB1 Protein, GST-tagged
| Cat.No. : | CCNB1-2959HF |
| Product Overview : | Human CCNB1 full-length ORF (NP_114172.1, 1 a.a. - 433 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 433 amino acids |
| Description : | The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 74.7 kDa |
| AA Sequence : | MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCNB1 cyclin B1 [ Homo sapiens ] |
| Official Symbol | CCNB1 |
| Synonyms | CCNB1; cyclin B1; CCNB; G2/mitotic-specific cyclin-B1; G2/mitotic specific cyclin B1; G2/mitotic-specific cyclin B1; |
| Gene ID | 891 |
| mRNA Refseq | NM_031966 |
| Protein Refseq | NP_114172 |
| MIM | 123836 |
| UniProt ID | P14635 |
| ◆ Recombinant Proteins | ||
| CCNB1-353H | Recombinant Human CCNB1 protein, His/MBP-tagged | +Inquiry |
| CCNB1-525R | Recombinant Rhesus Macaque CCNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CCNB1-9062Z | Recombinant Zebrafish CCNB1 | +Inquiry |
| CCNB1-1218R | Recombinant Rat CCNB1 Protein | +Inquiry |
| CCNB1-876R | Recombinant Rat CCNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNB1 Products
Required fields are marked with *
My Review for All CCNB1 Products
Required fields are marked with *
