Recombinant Full Length Human CCNH Protein, GST-tagged
Cat.No. : | CCNH-2976HF |
Product Overview : | Human CCNH full-length ORF (NP_001230.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Nov 2010] |
Molecular Mass : | 64 kDa |
AA Sequence : | MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNH cyclin H [ Homo sapiens ] |
Official Symbol | CCNH |
Synonyms | CCNH; cyclin H; cyclin-H; CAK complex subunit; CDK activating kinase complex subunit; cyclin dependent kinase activating kinase complex subunit; MO15 associated protein; p34; p37; MO15-associated protein; CDK-activating kinase complex subunit; cyclin-dependent kinase-activating kinase complex subunit; CAK; |
Gene ID | 902 |
mRNA Refseq | NM_001199189 |
Protein Refseq | NP_001186118 |
MIM | 601953 |
UniProt ID | P51946 |
◆ Recombinant Proteins | ||
CCNH-525H | Recombinant Human CCNH Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNH-376C | Recombinant Cynomolgus CCNH Protein, His-tagged | +Inquiry |
CCNH-529R | Recombinant Rhesus Macaque CCNH Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNH-3493H | Recombinant Human CCNH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCNH-2976HF | Recombinant Full Length Human CCNH Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNH-7705HCL | Recombinant Human CCNH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNH Products
Required fields are marked with *
My Review for All CCNH Products
Required fields are marked with *