Recombinant Full Length Human CCNJL Protein, GST-tagged
Cat.No. : | CCNJL-4869HF |
Product Overview : | Human FLJ14166 full-length ORF ( AAH13353.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | CCNJL (Cyclin J Like) is a Protein Coding gene. An important paralog of this gene is CCNJ. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MVPGTPPTPTQVLFQPPAYPALGQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQPLDMCPVPVPASLSMHMAIAAEPRHCLATTYGSSYFSGSHMFPTGCFDR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCNJL cyclin J-like [ Homo sapiens ] |
Official Symbol | CCNJL |
Synonyms | Ccnjl; CCNJL_HUMAN; Cyclin J like; Cyclin J like protein; Cyclin-J-like protein; FLJ14166; |
Gene ID | 79616 |
mRNA Refseq | NM_024565 |
Protein Refseq | NP_078841 |
UniProt ID | Q8IV13 |
◆ Recombinant Proteins | ||
CCNJL-1412M | Recombinant Mouse CCNJL Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNJL-4247H | Recombinant Human CCNJL Protein, GST-tagged | +Inquiry |
CCNJL-1354H | Recombinant Human CCNJL Protein (315-435 aa), His-tagged | +Inquiry |
Ccnjl-2049M | Recombinant Mouse Ccnjl Protein, Myc/DDK-tagged | +Inquiry |
CCNJL-3000M | Recombinant Mouse CCNJL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNJL-7702HCL | Recombinant Human CCNJL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNJL Products
Required fields are marked with *
My Review for All CCNJL Products
Required fields are marked with *