Recombinant Full Length Human CD24 Protein, GST-tagged

Cat.No. : CD24-3037HF
Product Overview : Human CD24 full-length ORF (AAH07674, 28 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 28-80 amino acids
Description : This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Molecular Mass : 31.57 kDa
AA Sequence : ETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CD24 CD24 molecule [ Homo sapiens ]
Official Symbol CD24
Synonyms CD24; CD24 molecule; CD24 antigen (small cell lung carcinoma cluster 4 antigen); signal transducer CD24; CD24A; FLJ22950; FLJ43543; MGC75043;
Gene ID 100133941
mRNA Refseq NM_013230
Protein Refseq NP_037362
MIM 600074
UniProt ID P25063

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD24 Products

Required fields are marked with *

My Review for All CD24 Products

Required fields are marked with *

0
cart-icon
0
compare icon