Recombinant Full Length Human CD24 Protein, GST-tagged

• Cat.No.: CD24-3037HF
• Product Overview: Human CD24 full-length ORF (AAH07674, 28 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 28-80 amino acids
• Description: This gene encodes a sialoglycoprotein that is expressed on mature granulocytes and B cells and modulates growth and differentiation signals to these cells. The precursor protein is cleaved to a short 32 amino acid mature peptide which is anchored via a glycosyl phosphatidylinositol (GPI) link to the cell surface. This gene was missing from previous genome assemblies, but is properly located on chromosome 6. Non-transcribed pseudogenes have been designated on chromosomes 1, 15, 20, and Y. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
• Molecular Mass: 31.57 kDa
• AA Sequence: ETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CD24 CD24 molecule [ Homo sapiens ]
• Official Symbol: CD24
• Synonyms: CD24; CD24 molecule; CD24 antigen (small cell lung carcinoma cluster 4 antigen); signal transducer CD24; CD24A; FLJ22950; FLJ43543; MGC75043
• Gene ID: 100133941
• mRNA Refseq: NM_013230
• Protein Refseq: NP_037362
• MIM: 600074
• UniProt ID: P25063