Recombinant Full Length Human CD300LB Protein, GST-tagged
Cat.No. : | CD300LB-3133HF |
Product Overview : | Human CD300LB full-length ORF (NP_777552.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 238 amino acids |
Description : | CD300LB is a nonclassical activating receptor of the immunoglobulin (Ig) superfamily expressed on myeloid cells (Martinez-Barriocanal and Sayos, 2006 [PubMed 16920917]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MCRRCKPELGQNFQSASGICICHWLQIRRTRSREGRAMWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD300LB CD300 molecule-like family member b [ Homo sapiens ] |
Official Symbol | CD300LB |
Synonyms | CD_antigen=CD300b; CD300 antigen-like family member B; CD300 molecule-like family member b; CD300B; CLM 7; CLM7; CLM7_HUMAN; CMRF35 A2; CMRF35-like molecule 7; CMRF35A2; Immune receptor expressed on myeloid cells 3; IREM 3; IREM3; Leukocyte mono-Ig-like receptor 5; LMIR5; TREM 5; TREM5; Triggering receptor expressed on myeloid cells 5; UNQ2530/PRO6029; |
Gene ID | 124599 |
mRNA Refseq | NM_174892 |
Protein Refseq | NP_777552 |
MIM | 610705 |
UniProt ID | A8K4G0 |
◆ Recombinant Proteins | ||
CD300LB-2661H | Recombinant Human CD300LB protein, His-tagged | +Inquiry |
CD300LB-564H | Recombinant Human CD300LB Protein, Fc-tagged | +Inquiry |
CD300LB-1258H | Recombinant Human CD300LB protein, His-tagged | +Inquiry |
CD300LB-565H | Recombinant Human CD300LB(Ile55-His187) Protein, C-Fc-tagged | +Inquiry |
CD300LB-10941H | Recombinant Human CD300LB, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300LB-176HCL | Recombinant Human CD300LB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD300LB Products
Required fields are marked with *
My Review for All CD300LB Products
Required fields are marked with *
0
Inquiry Basket