Recombinant Full Length Human CD320 Protein, GST-tagged
Cat.No. : | CD320-3160HF |
Product Overview : | Human CD320 full-length ORF (AAH00668, 1 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 282 amino acids |
Description : | This gene encodes the transcobalamin receptor that is expressed at the cell surface. It mediates the cellular uptake of transcobalamin bound cobalamin (vitamin B12), and is involved in B-cell proliferation and immunoglobulin secretion. Mutations in this gene are associated with methylmalonic aciduria. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2011] |
Molecular Mass : | 56.76 kDa |
AA Sequence : | MSGGWMAQVGAWRTGALGLALLLLLGLGLGLEAAASPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGVIAAAAVLSASLVTATLLLLSWLRAQERLRPLGLLVAMKESLLLSEQKTSLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD320 CD320 molecule [ Homo sapiens (human) ] |
Official Symbol | CD320 |
Synonyms | CD320; CD320 molecule; 8D6; 8D6A; TCBLR; CD320 antigen; 8D6 antigen; FDC-SM-8D6; FDC-signaling molecule 8D6; transcobalamin receptor; CD320 Antigen; 8D6 Antigen; FDC-Signaling Molecule 8D6; Transcobalamin Receptor; FDC-SM-8D6 |
Gene ID | 51293 |
mRNA Refseq | NM_001165895 |
Protein Refseq | NP_001159367 |
MIM | 606475 |
UniProt ID | Q9NPF0 |
◆ Recombinant Proteins | ||
CD320-3160HF | Recombinant Full Length Human CD320 Protein, GST-tagged | +Inquiry |
CD320-1249H | Recombinant Human CD320 Protein (36-231 aa), GST-tagged | +Inquiry |
Cd320-5714R | Recombinant Rat Cd320 protein, His & GST-tagged | +Inquiry |
Cd320-485M | Recombinant Mouse Cd320, His-tagged | +Inquiry |
CD320-3437C | Recombinant Chicken CD320 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD320-001MCL | Recombinant Mouse CD320 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD320 Products
Required fields are marked with *
My Review for All CD320 Products
Required fields are marked with *
0
Inquiry Basket