Recombinant Full Length Human CD3E Protein, GST-tagged
Cat.No. : | CD3E-3174HF |
Product Overview : | Human CD3E full-length ORF (AAH49847.1, 23 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 23-207 amino acids |
Description : | The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 46.09 kDa |
AA Sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQRNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Homo sapiens ] |
Official Symbol | CD3E |
Synonyms | CD3E; CD3e molecule, epsilon (CD3-TCR complex); CD3e antigen, epsilon polypeptide (TiT3 complex); T-cell surface glycoprotein CD3 epsilon chain; CD3-epsilon; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell antigen receptor complex, epsilon subunit of T3; T3E; TCRE; FLJ18683; |
Gene ID | 916 |
mRNA Refseq | NM_000733 |
Protein Refseq | NP_000724 |
MIM | 186830 |
UniProt ID | P07766 |
◆ Recombinant Proteins | ||
CD3E-1055C | Recombinant Canine CD3E Protein, Fc-tagged | +Inquiry |
CD3E-213H | Recombinant Human CD3E protein, His-tagged | +Inquiry |
CD3e-1115R | Recombinant Rat CD3e Protein, Fc-tagged | +Inquiry |
CD3E-326W | Recombinant Western lowland gorilla CD3E protein, His-tagged | +Inquiry |
CD3E-5895H | Recombinant Human CD3E protein, hFc-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *