Recombinant Full Length Human CD7 Protein
Cat.No. : | CD7-80HF |
Product Overview : | Recombinant full length mature Human CD7 with a N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 220 amino acids |
Description : | This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. |
Form : | Liquid |
Molecular Mass : | 50.310kDa inclusive of tags |
AA Sequence : | PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLR QLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT MHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWH RCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP AALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACV VYEDMSHSRCNTLSSPNQYQ |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CD7 CD7 molecule [ Homo sapiens ] |
Official Symbol | CD7 |
Synonyms | CD7; CD7 molecule; CD7 antigen (p41); T-cell antigen CD7; GP40; LEU 9; p41 protein; T cell antigen CD7; T cell leukemia antigen; Tp40; TP41 |
Gene ID | 924 |
mRNA Refseq | NM_006137 |
Protein Refseq | NP_006128 |
MIM | 186820 |
UniProt ID | P09564 |
◆ Recombinant Proteins | ||
CD7-2337M | Recombinant Mouse CD7 protein(Met1-Pro150), hFc-tagged | +Inquiry |
CD7-175H | Recombinant Human CD7 Protein, C-His-tagged | +Inquiry |
CD7-6834HF | Recombinant Full Length Human CD7 Protein | +Inquiry |
CD7-3009H | Recombinant Human CD7 protein, His-tagged, FITC-Labeled | +Inquiry |
CD7-2226H | Active Recombinant Human CD7, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD7-1368RCL | Recombinant Rat CD7 cell lysate | +Inquiry |
CD7-2607HCL | Recombinant Human CD7 cell lysate | +Inquiry |
CD7-2518MCL | Recombinant Mouse CD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD7 Products
Required fields are marked with *
My Review for All CD7 Products
Required fields are marked with *