Recombinant Full Length Human CD7 Protein

• Cat.No.: CD7-6834HF
• Product Overview: Human CD7 full-length ORF (NP_006128.1) recombinant protein without tag was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 317 amino acids
• Description: This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
• Form: Liquid
• Molecular Mass: 25.4 kDa
• AA Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CD7 CD7 molecule [ Homo sapiens (human) ]
• Official Symbol: CD7
• Synonyms: CD7; CD7 molecule; GP40; TP41; Tp40; LEU-9; T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
• Gene ID: 924
• mRNA Refseq: NM_006137
• Protein Refseq: NP_006128
• MIM: 186820
• UniProt ID: P09564