Recombinant Full Length Human CD7 Protein

Cat.No. : CD7-6834HF
Product Overview : Human CD7 full-length ORF (NP_006128.1) recombinant protein without tag was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 317 amino acids
Description : This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
Form : Liquid
Molecular Mass : 25.4 kDa
AA Sequence : MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name CD7 CD7 molecule [ Homo sapiens (human) ]
Official Symbol CD7
Synonyms CD7; CD7 molecule; GP40; TP41; Tp40; LEU-9; T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
Gene ID 924
mRNA Refseq NM_006137
Protein Refseq NP_006128
MIM 186820
UniProt ID P09564

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD7 Products

Required fields are marked with *

My Review for All CD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon