Recombinant Full Length Human Cd83 Antigen(Cd83) Protein, His-Tagged
Cat.No. : | RFL26408HF |
Product Overview : | Recombinant Full Length Human CD83 antigen(CD83) Protein (Q01151) (20-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-205) |
Form : | Lyophilized powder |
AA Sequence : | TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD83 |
Synonyms | CD83; CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83 |
UniProt ID | Q01151 |
◆ Recombinant Proteins | ||
CD83-151H | Recombinant Human CD83 Protein, His-tagged | +Inquiry |
CD83-8850C | Recombinant Cynomolgus CD83, Fc tagged | +Inquiry |
CD83-301473H | Recombinant Human CD83 protein, GST-tagged | +Inquiry |
CD83-751R | Recombinant Cynomolgus/Rhesus CD83 protein(Met1-Ala143), His-tagged | +Inquiry |
CD83-102C | Recombinant Cynomolgus/Rhesus CD83 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD83-1432RCL | Recombinant Rat CD83 cell lysate | +Inquiry |
CD83-2095HCL | Recombinant Human CD83 cell lysate | +Inquiry |
CD83-1845MCL | Recombinant Mouse CD83 cell lysate | +Inquiry |
CD83-1130CCL | Recombinant Cynomolgus CD83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD83 Products
Required fields are marked with *
My Review for All CD83 Products
Required fields are marked with *