Recombinant Full Length Human CDC25C Protein, GST-tagged

Cat.No. : CDC25C-3054HF
Product Overview : Human CDC25C full-length ORF (AAH19089.1, 1 a.a. - 473 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 473 amino acids
Description : This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]
Molecular Mass : 79.7 kDa
AA Sequence : MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDC25C cell division cycle 25 homolog C (S. pombe) [ Homo sapiens ]
Official Symbol CDC25C
Synonyms CDC25C; cell division cycle 25 homolog C (S. pombe); CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25C; M-phase inducer phosphatase 3; PPP1R60; protein phosphatase 1; regulatory subunit 60; mitosis inducer CDC25; cell division cycle 25C; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60; CDC25;
Gene ID 995
mRNA Refseq NM_001790
Protein Refseq NP_001781
MIM 157680
UniProt ID P30307

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDC25C Products

Required fields are marked with *

My Review for All CDC25C Products

Required fields are marked with *

0
cart-icon