Recombinant Full Length Human CDC25C Protein, GST-tagged
| Cat.No. : | CDC25C-3054HF |
| Product Overview : | Human CDC25C full-length ORF (AAH19089.1, 1 a.a. - 473 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 473 amino acids |
| Description : | This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015] |
| Molecular Mass : | 79.7 kDa |
| AA Sequence : | MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDC25C cell division cycle 25 homolog C (S. pombe) [ Homo sapiens ] |
| Official Symbol | CDC25C |
| Synonyms | CDC25C; cell division cycle 25 homolog C (S. pombe); CDC25, cell division cycle 25 homolog C (S. cerevisiae), cell division cycle 25C; M-phase inducer phosphatase 3; PPP1R60; protein phosphatase 1; regulatory subunit 60; mitosis inducer CDC25; cell division cycle 25C; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60; CDC25; |
| Gene ID | 995 |
| mRNA Refseq | NM_001790 |
| Protein Refseq | NP_001781 |
| MIM | 157680 |
| UniProt ID | P30307 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC25C Products
Required fields are marked with *
My Review for All CDC25C Products
Required fields are marked with *
