Recombinant Full Length Human CDC42EP3 Protein, GST-tagged
| Cat.No. : | CDC42EP3-3777HF |
| Product Overview : | Human CDC42EP3 full-length ORF ( AAH19270, 1 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 254 amino acids |
| Description : | This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
| Molecular Mass : | 53.68 kDa |
| AA Sequence : | MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDC42EP3 CDC42 effector protein 3 [ Homo sapiens (human) ] |
| Official Symbol | CDC42EP3 |
| Synonyms | CDC42EP3; CDC42 effector protein 3; UB1; CEP3; BORG2; cdc42 effector protein 3; CDC42 effector protein (Rho GTPase binding) 3; CRIB-containing BORG2 protein; MSE55-related Cdc42-binding protein; MSE55-related protein; binder of Rho GTPases 2 |
| Gene ID | 10602 |
| mRNA Refseq | NM_001270436 |
| Protein Refseq | NP_001257365 |
| MIM | 606133 |
| UniProt ID | Q9UKI2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDC42EP3 Products
Required fields are marked with *
My Review for All CDC42EP3 Products
Required fields are marked with *
