Recombinant Full Length Human CDC42EP3 Protein, GST-tagged

• Cat.No.: CDC42EP3-3777HF
• Product Overview: Human CDC42EP3 full-length ORF ( AAH19270, 1 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 254 amino acids
• Description: This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
• Molecular Mass: 53.68 kDa
• AA Sequence: MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC42EP3 CDC42 effector protein 3 [ Homo sapiens (human) ]
• Official Symbol: CDC42EP3
• Synonyms: CDC42EP3; CDC42 effector protein 3; UB1; CEP3; BORG2; cdc42 effector protein 3; CDC42 effector protein (Rho GTPase binding) 3; CRIB-containing BORG2 protein; MSE55-related Cdc42-binding protein; MSE55-related protein; binder of Rho GTPases 2
• Gene ID: 10602
• mRNA Refseq: NM_001270436
• Protein Refseq: NP_001257365
• MIM: 606133
• UniProt ID: Q9UKI2