Recombinant Full Length Human CDCA4 Protein, GST-tagged

Cat.No. : CDCA4-3115HF
Product Overview : Human CDCA4 full-length ORF (NP_663747.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 241 amino acids
Description : This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulation of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq, May 2014]
Molecular Mass : 52.5 kDa
AA Sequence : MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDCA4 cell division cycle associated 4 [ Homo sapiens ]
Official Symbol CDCA4
Synonyms CDCA4; cell division cycle associated 4; cell division cycle-associated protein 4; FLJ20764; hematopoietic progenitor protein; Hepp; HEPP; SEI-3/HEPP; FLJ52878; MGC19517;
Gene ID 55038
mRNA Refseq NM_017955
Protein Refseq NP_060425
MIM 612270
UniProt ID Q9BXL8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDCA4 Products

Required fields are marked with *

My Review for All CDCA4 Products

Required fields are marked with *

0
cart-icon
0
compare icon