Recombinant Full Length Human CDCA4 Protein, GST-tagged
Cat.No. : | CDCA4-3115HF |
Product Overview : | Human CDCA4 full-length ORF (NP_663747.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 241 amino acids |
Description : | This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulation of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq, May 2014] |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDCA4 cell division cycle associated 4 [ Homo sapiens ] |
Official Symbol | CDCA4 |
Synonyms | CDCA4; cell division cycle associated 4; cell division cycle-associated protein 4; FLJ20764; hematopoietic progenitor protein; Hepp; HEPP; SEI-3/HEPP; FLJ52878; MGC19517; |
Gene ID | 55038 |
mRNA Refseq | NM_017955 |
Protein Refseq | NP_060425 |
MIM | 612270 |
UniProt ID | Q9BXL8 |
◆ Recombinant Proteins | ||
CDCA4-0961H | Recombinant Human CDCA4 Protein, GST-Tagged | +Inquiry |
CDCA4-11023H | Recombinant Human CDCA4, GST-tagged | +Inquiry |
CDCA4-293H | Recombinant Human CDCA4 Protein, His-tagged | +Inquiry |
CDCA4-1497M | Recombinant Mouse CDCA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDCA4-3156M | Recombinant Mouse CDCA4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDCA4-7643HCL | Recombinant Human CDCA4 293 Cell Lysate | +Inquiry |
CDCA4-7642HCL | Recombinant Human CDCA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDCA4 Products
Required fields are marked with *
My Review for All CDCA4 Products
Required fields are marked with *
0
Inquiry Basket