Recombinant Full Length Human CDIPT Protein, GST-tagged
| Cat.No. : | CDIPT-3153HF |
| Product Overview : | Human CDIPT full-length ORF (AAH01444, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 213 amino acids |
| Description : | Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013] |
| Molecular Mass : | 49.17 kDa |
| AA Sequence : | MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase [ Homo sapiens ] |
| Official Symbol | CDIPT |
| Synonyms | CDIPT; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase); phosphatidylinositol synthase; PIS; PIS1; PI synthase; PtdIns synthase; MGC1328; |
| Gene ID | 10423 |
| mRNA Refseq | NM_006319 |
| Protein Refseq | NP_006310 |
| MIM | 605893 |
| UniProt ID | O14735 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDIPT Products
Required fields are marked with *
My Review for All CDIPT Products
Required fields are marked with *
