Recombinant Full Length Human CDIPT Protein, GST-tagged

• Cat.No.: CDIPT-3153HF
• Product Overview: Human CDIPT full-length ORF (AAH01444, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 213 amino acids
• Description: Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
• Molecular Mass: 49.17 kDa
• AA Sequence: MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase [ Homo sapiens ]
• Official Symbol: CDIPT
• Synonyms: CDIPT; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase); phosphatidylinositol synthase; PIS; PIS1; PI synthase; PtdIns synthase; MGC1328
• Gene ID: 10423
• mRNA Refseq: NM_006319
• Protein Refseq: NP_006310
• MIM: 605893
• UniProt ID: O14735