Recombinant Full Length Human CDIPT Protein, GST-tagged

Cat.No. : CDIPT-3153HF
Product Overview : Human CDIPT full-length ORF (AAH01444, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 213 amino acids
Description : Phosphatidylinositol breakdown products are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. Two enzymes, CDP-diacylglycerol synthase and phosphatidylinositol synthase, are involved in the biosynthesis of phosphatidylinositol. Phosphatidylinositol synthase, a member of the CDP-alcohol phosphatidyl transferase class-I family, is an integral membrane protein found on the cytoplasmic side of the endoplasmic reticulum and the Golgi apparatus. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Molecular Mass : 49.17 kDa
AA Sequence : MPDENIFLFVPNLIGYARIVFAIISFYFMPCCPLTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDIPT CDP-diacylglycerol--inositol 3-phosphatidyltransferase [ Homo sapiens ]
Official Symbol CDIPT
Synonyms CDIPT; CDP-diacylglycerol--inositol 3-phosphatidyltransferase; CDP diacylglycerol inositol 3 phosphatidyltransferase (phosphatidylinositol synthase); phosphatidylinositol synthase; PIS; PIS1; PI synthase; PtdIns synthase; MGC1328;
Gene ID 10423
mRNA Refseq NM_006319
Protein Refseq NP_006310
MIM 605893
UniProt ID O14735

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDIPT Products

Required fields are marked with *

My Review for All CDIPT Products

Required fields are marked with *

0
cart-icon