Recombinant Full Length Human CDK20 Protein, GST-tagged

Cat.No. : CDK20-3780HF
Product Overview : Human CCRK full-length ORF ( AAH02655, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 275 amino acids
Description : The protein encoded by this gene contains a kinase domain most closely related to the cyclin-dependent protein kinases. The encoded kinase may activate cyclin-dependent kinase 2 and is involved in cell growth. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Dec 2009]
Molecular Mass : 55.99 kDa
AA Sequence : MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK20 cyclin dependent kinase 20 [ Homo sapiens (human) ]
Official Symbol CDK20
Synonyms CCRK; CDK20; cyclin dependent kinase 20; P42; CCRK; CDCH; PNQALRE; cyclin-dependent kinase 20; CAK-kinase p42; CDK-activating kinase p42; cell cycle-related kinase; cell division protein kinase 20; cyclin-dependent protein kinase H; cyclin-kinase-activating kinase p42; EC 2.7.11.22
Gene ID 23552
mRNA Refseq NM_001039803
Protein Refseq NP_001034892
MIM 610076
UniProt ID Q8IZL9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK20 Products

Required fields are marked with *

My Review for All CDK20 Products

Required fields are marked with *

0
cart-icon