Recombinant Full Length Human CDK2AP2 Protein, GST-tagged
Cat.No. : | CDK2AP2-3180HF |
Product Overview : | Human CDK2AP2 full-length ORF (AAH02850.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 126 amino acids |
Description : | This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Molecular Mass : | 39.49 kDa |
AA Sequence : | MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDK2AP2 cyclin-dependent kinase 2 associated protein 2 [ Homo sapiens ] |
Official Symbol | CDK2AP2 |
Synonyms | CDK2AP2; cyclin-dependent kinase 2 associated protein 2; CDK2 associated protein 2; cyclin-dependent kinase 2-associated protein 2; DOC 1R; p14; tumor suppressor deleted in oral cancer related 1; DOC-1-related protein; CDK2-associated protein 2; tumor suppressor deleted in oral cancer-related 1; DOC-1R; FLJ10636; |
Gene ID | 10263 |
mRNA Refseq | NM_005851 |
Protein Refseq | NP_005842 |
UniProt ID | O75956 |
◆ Recombinant Proteins | ||
Cdk2ap2-2089M | Recombinant Mouse Cdk2ap2 Protein, Myc/DDK-tagged | +Inquiry |
CDK2AP2-1977Z | Recombinant Zebrafish CDK2AP2 | +Inquiry |
CDK2AP2-1006H | Recombinant Human CDK2AP2 Protein, GST-Tagged | +Inquiry |
CDK2AP2-3354H | Recombinant Human CDK2AP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CDK2AP2-609R | Recombinant Rhesus Macaque CDK2AP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK2AP2-7627HCL | Recombinant Human CDK2AP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDK2AP2 Products
Required fields are marked with *
My Review for All CDK2AP2 Products
Required fields are marked with *