Recombinant Full Length Human CDK2AP2 Protein, GST-tagged

Cat.No. : CDK2AP2-3180HF
Product Overview : Human CDK2AP2 full-length ORF (AAH02850.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 126 amino acids
Description : This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]
Molecular Mass : 39.49 kDa
AA Sequence : MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDK2AP2 cyclin-dependent kinase 2 associated protein 2 [ Homo sapiens ]
Official Symbol CDK2AP2
Synonyms CDK2AP2; cyclin-dependent kinase 2 associated protein 2; CDK2 associated protein 2; cyclin-dependent kinase 2-associated protein 2; DOC 1R; p14; tumor suppressor deleted in oral cancer related 1; DOC-1-related protein; CDK2-associated protein 2; tumor suppressor deleted in oral cancer-related 1; DOC-1R; FLJ10636;
Gene ID 10263
mRNA Refseq NM_005851
Protein Refseq NP_005842
UniProt ID O75956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDK2AP2 Products

Required fields are marked with *

My Review for All CDK2AP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon