Recombinant Full Length Human CDKN2AIPNL Protein, GST-tagged

Cat.No. : CDKN2AIPNL-3830HF
Product Overview : Human CDKN2AIPNL full-length ORF ( ADZ15778.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 116 amino acids
Description : CDKN2AIPNL (CDKN2A Interacting Protein N-Terminal Like) is a Protein Coding gene. An important paralog of this gene is CDKN2AIP.
Molecular Mass : 12.8 kDa
AA Sequence : MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKN2AIPNL CDKN2A interacting protein N-terminal like [ Homo sapiens (human) ]
Official Symbol CDKN2AIPNL
Synonyms CDKN2AIPNL; CDKN2A interacting protein N-terminal like; CDKN2AIP N-terminal-like protein; CDKN2A-interacting protein N-terminal-like protein
Gene ID 91368
mRNA Refseq NM_080656
Protein Refseq NP_542387
UniProt ID Q96HQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDKN2AIPNL Products

Required fields are marked with *

My Review for All CDKN2AIPNL Products

Required fields are marked with *

0
cart-icon