Recombinant Full Length Human CEACAM21 Protein, GST-tagged
| Cat.No. : | CEACAM21-3273HF |
| Product Overview : | Human CEACAM21 full-length ORF (AAH12001.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 191 amino acids |
| Description : | CEACAM21 (Carcinoembryonic Antigen Related Cell Adhesion Molecule 21) is a Protein Coding gene. An important paralog of this gene is CEACAM1. |
| Molecular Mass : | 47.9 kDa |
| AA Sequence : | MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CEACAM21 carcinoembryonic antigen-related cell adhesion molecule 21 [ Homo sapiens ] |
| Official Symbol | CEACAM21 |
| Synonyms | CEACAM21; carcinoembryonic antigen-related cell adhesion molecule 21; FLJ13540; R29124_1; CEACAM3; MGC119874; |
| Gene ID | 90273 |
| mRNA Refseq | NM_001098506 |
| Protein Refseq | NP_001091976 |
| MIM | 618191 |
| UniProt ID | Q3KPI0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CEACAM21 Products
Required fields are marked with *
My Review for All CEACAM21 Products
Required fields are marked with *
