Recombinant Full Length Human CENPN Protein, GST-tagged

Cat.No. : CENPN-1720HF
Product Overview : Human BM039 full-length ORF ( AAH07334, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 204 amino acids
Description : The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]).
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 48.18 kDa
AA Sequence : MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPN centromere protein N [ Homo sapiens ]
Official Symbol CENPN
Synonyms CENPN; centromere protein N; C16orf60, chromosome 16 open reading frame 60; BM039; FLJ13607; FLJ22660; interphase centromere complex protein 32; CENP-N; C16orf60
Gene ID 55839
mRNA Refseq NM_001100624
Protein Refseq NP_001094094
MIM 611509
UniProt ID Q96H22

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CENPN Products

Required fields are marked with *

My Review for All CENPN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon