Recombinant Full Length Human CENPN Protein, GST-tagged
Cat.No. : | CENPN-1720HF |
Product Overview : | Human BM039 full-length ORF ( AAH07334, 1 a.a. - 204 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 204 amino acids |
Description : | The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is an additional factor required for centromere assembly (Foltz et al., 2006 [PubMed 16622419]). |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 48.18 kDa |
AA Sequence : | MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQKVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQELEATGKIYLRQEEIILDITEMKKACN |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CENPN centromere protein N [ Homo sapiens ] |
Official Symbol | CENPN |
Synonyms | CENPN; centromere protein N; C16orf60, chromosome 16 open reading frame 60; BM039; FLJ13607; FLJ22660; interphase centromere complex protein 32; CENP-N; C16orf60 |
Gene ID | 55839 |
mRNA Refseq | NM_001100624 |
Protein Refseq | NP_001094094 |
MIM | 611509 |
UniProt ID | Q96H22 |
◆ Recombinant Proteins | ||
CENPN-1582M | Recombinant Mouse CENPN Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPN-490Z | Recombinant Zebrafish CENPN | +Inquiry |
CENPN-1720HF | Recombinant Full Length Human CENPN Protein, GST-tagged | +Inquiry |
CENPN-254H | Recombinant Human CENPN Protein, GST-tagged | +Inquiry |
CENPN-993R | Recombinant Rat CENPN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPN-7579HCL | Recombinant Human CENPN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPN Products
Required fields are marked with *
My Review for All CENPN Products
Required fields are marked with *