Recombinant Full Length Human CENPW Protein, GST-tagged
| Cat.No. : | CENPW-3912HF |
| Product Overview : | Human CENPW full-length ORF (NP_001012525.1, 1 a.a. - 88 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 88 amino acids |
| Description : | CENPW (Centromere Protein W) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic. GO annotations related to this gene include protein heterodimerization activity. |
| Molecular Mass : | 36.08 kDa |
| AA Sequence : | MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CENPW centromere protein W [ Homo sapiens (human) ] |
| Official Symbol | CENPW |
| Synonyms | CENPW; centromere protein W; CUG2; CENP-W; C6orf173; centromere protein W; cancer-up-regulated gene 2 protein; cancer-upregulated gene 2 |
| Gene ID | 387103 |
| mRNA Refseq | NM_001012507 |
| Protein Refseq | NP_001012525 |
| MIM | 611264 |
| UniProt ID | Q5EE01 |
| ◆ Recombinant Proteins | ||
| CENPW-815R | Recombinant Rhesus monkey CENPW Protein, His-tagged | +Inquiry |
| CENPW-5101C | Recombinant Chicken CENPW | +Inquiry |
| CENPW-2654H | Recombinant Human CENPW Protein, His (Fc)-Avi-tagged | +Inquiry |
| CENPW-1046H | Recombinant Human CENPW | +Inquiry |
| CENPW-2725H | Recombinant Human CENPW protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CENPW-7990HCL | Recombinant Human C6orf173 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CENPW Products
Required fields are marked with *
My Review for All CENPW Products
Required fields are marked with *



