Recombinant Full Length Human CENPW Protein, GST-tagged

• Cat.No.: CENPW-3912HF
• Product Overview: Human CENPW full-length ORF (NP_001012525.1, 1 a.a. - 88 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 88 amino acids
• Description: CENPW (Centromere Protein W) is a Protein Coding gene. Among its related pathways are Chromosome Maintenance and Cell Cycle, Mitotic. GO annotations related to this gene include protein heterodimerization activity.
• Molecular Mass: 36.08 kDa
• AA Sequence: MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CENPW centromere protein W [ Homo sapiens (human) ]
• Official Symbol: CENPW
• Synonyms: CENPW; centromere protein W; CUG2; CENP-W; C6orf173; centromere protein W; cancer-up-regulated gene 2 protein; cancer-upregulated gene 2
• Gene ID: 387103
• mRNA Refseq: NM_001012507
• Protein Refseq: NP_001012525
• MIM: 611264
• UniProt ID: Q5EE01