Recombinant Full Length Human CERK Protein, GST-tagged
| Cat.No. : | CERK-3248HF | 
| Product Overview : | Human CERK full-length ORF (AAH04278, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 201 amino acids | 
| Description : | CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008] | 
| Molecular Mass : | 47.85 kDa | 
| AA Sequence : | MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CERK ceramide kinase [ Homo sapiens ] | 
| Official Symbol | CERK | 
| Synonyms | CERK; ceramide kinase; dA59H18.2; dA59H18.3; DKFZp434E0211; FLJ21430; FLJ23239; hCERK; KIAA1646; LK4; lipid kinase 4; lipid kinase LK4; acylsphingosine kinase; MGC131878; | 
| Gene ID | 64781 | 
| mRNA Refseq | NM_022766 | 
| Protein Refseq | NP_073603 | 
| MIM | 610307 | 
| UniProt ID | Q8TCT0 | 
| ◆ Recombinant Proteins | ||
| CERK-3319M | Recombinant Mouse CERK Protein | +Inquiry | 
| CERK-1598M | Recombinant Mouse CERK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CERK-648R | Recombinant Rhesus Macaque CERK Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CERK-3248HF | Recombinant Full Length Human CERK Protein, GST-tagged | +Inquiry | 
| CERK-508H | Active Recombinant Human CERK, Flag-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CERK Products
Required fields are marked with *
My Review for All CERK Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            