Recombinant Full Length Human CERK Protein, GST-tagged
Cat.No. : | CERK-3248HF |
Product Overview : | Human CERK full-length ORF (AAH04278, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 47.85 kDa |
AA Sequence : | MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CERK ceramide kinase [ Homo sapiens ] |
Official Symbol | CERK |
Synonyms | CERK; ceramide kinase; dA59H18.2; dA59H18.3; DKFZp434E0211; FLJ21430; FLJ23239; hCERK; KIAA1646; LK4; lipid kinase 4; lipid kinase LK4; acylsphingosine kinase; MGC131878; |
Gene ID | 64781 |
mRNA Refseq | NM_022766 |
Protein Refseq | NP_073603 |
MIM | 610307 |
UniProt ID | Q8TCT0 |
◆ Recombinant Proteins | ||
CERK-3248HF | Recombinant Full Length Human CERK Protein, GST-tagged | +Inquiry |
CERK-11123H | Recombinant Human CERK, GST-tagged | +Inquiry |
CERK-1598M | Recombinant Mouse CERK Protein, His (Fc)-Avi-tagged | +Inquiry |
CERK-6010Z | Recombinant Zebrafish CERK | +Inquiry |
CERK-508H | Active Recombinant Human CERK, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CERK-7567HCL | Recombinant Human CERK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CERK Products
Required fields are marked with *
My Review for All CERK Products
Required fields are marked with *
0
Inquiry Basket