Recombinant Full Length Human CERK Protein, GST-tagged

Cat.No. : CERK-3248HF
Product Overview : Human CERK full-length ORF (AAH04278, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 201 amino acids
Description : CERK converts ceramide to ceramide 1-phosphate (C1P), a sphingolipid metabolite. Both CERK and C1P have been implicated in various cellular processes, including proliferation, apoptosis, phagocytosis, and inflammation (Kim et al., 2006 [PubMed 16488390]).[supplied by OMIM, Mar 2008]
Molecular Mass : 47.85 kDa
AA Sequence : MQRGPASGDPREGPPRQRREGCWGLHTCLITAARLRQSGWEHDLGVCSGSTDDKLWKLAVCKALASLLLLKCQIPMLYIDAKCLTQPGLGAVRRKLAIRGGGAGPGLPQDSSEAGPEVCTRGPDLSLSFLHTEFSIFIEHLVLLSQSSVNCVSDVCLLPRSHDGSLVSSAARGLRRPEDSSRKAFLPRSPGHPSIVYYVLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CERK ceramide kinase [ Homo sapiens ]
Official Symbol CERK
Synonyms CERK; ceramide kinase; dA59H18.2; dA59H18.3; DKFZp434E0211; FLJ21430; FLJ23239; hCERK; KIAA1646; LK4; lipid kinase 4; lipid kinase LK4; acylsphingosine kinase; MGC131878;
Gene ID 64781
mRNA Refseq NM_022766
Protein Refseq NP_073603
MIM 610307
UniProt ID Q8TCT0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CERK Products

Required fields are marked with *

My Review for All CERK Products

Required fields are marked with *

0
cart-icon