Recombinant Full Length Human CFAP300 Protein, GST-tagged

• Cat.No.: CFAP300-1875HF
• Product Overview: Human CFAP300 full-length ORF ( NP_116319.1, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 229 amino acids
• Description: Predicted to be located in cytoplasm and motile cilium. Implicated in primary ciliary dyskinesia 38.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 52.9 kDa
• AA Sequence: MLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CFAP300 cilia and flagella associated protein 300 [ Homo sapiens (human) ]
• Official Symbol: CFAP300
• Synonyms: C11orf70
• Gene ID: 85016
• mRNA Refseq: NM_032930.2
• Protein Refseq: NP_116319.2
• MIM: 618058
• UniProt ID: Q9BRQ4