Recombinant Full Length Human CFL2 Protein

• Cat.No.: CFL2-73HF
• Product Overview: Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag.

Specification

• Description: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 44.330kDa inclusive of tags
• Protein Length: 166 amino acids
• AA Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CFL2 cofilin 2 (muscle) [ Homo sapiens ]
• Official Symbol: CFL2
• Synonyms: CFL2; cofilin 2 (muscle); cofilin-2
• Gene ID: 1073
• mRNA Refseq: NM_001243645
• Protein Refseq: NP_001230574
• MIM: 601443
• UniProt ID: Q9Y281