Recombinant Full Length Human CFL2 Protein
| Cat.No. : | CFL2-73HF |
| Product Overview : | Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 166 amino acids |
| Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. |
| Form : | Liquid |
| Molecular Mass : | 44.330kDa inclusive of tags |
| AA Sequence : | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | CFL2 cofilin 2 (muscle) [ Homo sapiens ] |
| Official Symbol | CFL2 |
| Synonyms | CFL2; cofilin 2 (muscle); cofilin-2 |
| Gene ID | 1073 |
| mRNA Refseq | NM_001243645 |
| Protein Refseq | NP_001230574 |
| MIM | 601443 |
| UniProt ID | Q9Y281 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *



