Recombinant Full Length Human CFL2 Protein

Cat.No. : CFL2-73HF
Product Overview : Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 166 amino acids
Description : This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 44.330kDa inclusive of tags
AA Sequence : MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name CFL2 cofilin 2 (muscle) [ Homo sapiens ]
Official Symbol CFL2
Synonyms CFL2; cofilin 2 (muscle); cofilin-2
Gene ID 1073
mRNA Refseq NM_001243645
Protein Refseq NP_001230574
MIM 601443
UniProt ID Q9Y281

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFL2 Products

Required fields are marked with *

My Review for All CFL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon