Recombinant Full Length Human CHD9 Protein, GST-tagged
Cat.No. : | CHD9-3186HF |
Product Overview : | Human CHD9 full-length ORF (AAH33770, 1 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 119 amino acids |
Description : | CHD9 (Chromodomain Helicase DNA Binding Protein 9) is a Protein Coding gene. Among its related pathways are Mitochondrial Gene Expression and Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha). GO annotations related to this gene include nucleic acid binding and helicase activity. An important paralog of this gene is CHD7. |
Molecular Mass : | 38.83 kDa |
AA Sequence : | MLINLLVAQLNMCYLHTLSLIVLQSIPKTNPMVCFQMYQMAVQCGAIRQLLPFQIKMDLLFTNKDIHTLCIKIKALWHTMTLPYFRPMNNKHSVLHYAHNKTEIISTQGRILLASLKIL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHD9 chromodomain helicase DNA binding protein 9 [ Homo sapiens ] |
Official Symbol | CHD9 |
Synonyms | CHD9; chromodomain helicase DNA binding protein 9; chromodomain-helicase-DNA-binding protein 9; BC022889; FLJ12178; KIAA0308; CHD-9; proteinx0008; kismet homolog 2; ATP-dependent helicase CHD9; ciprofibrate bound protein p240; chromatin remodeling factor CHROM1; chromatin-remodeling factor CHROM1; chromatin-related mesenchymal modulator; PPAR{gamma}-interacting cofactor 320 kDa; PPAR-alpha-interacting complex protein 320 kDa; peroxisomal proliferator-activated receptor A-interacting complex 320 kDa protein; AD013; CReMM; KISH2; PRIC320; |
Gene ID | 80205 |
mRNA Refseq | NM_025134 |
Protein Refseq | NP_079410 |
MIM | 616936 |
UniProt ID | Q3L8U1 |
◆ Recombinant Proteins | ||
CHD9-3384M | Recombinant Mouse CHD9 Protein | +Inquiry |
CHD9-3186HF | Recombinant Full Length Human CHD9 Protein, GST-tagged | +Inquiry |
CHD9-1218H | Recombinant Human CHD9 Protein, GST-Tagged | +Inquiry |
CHD9-1636M | Recombinant Mouse CHD9 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD9 Products
Required fields are marked with *
My Review for All CHD9 Products
Required fields are marked with *